Antibodies

Jump to Filters
View as table Download
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA349647

USD 380.00

In Stock

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1E
Casein Kinase 1 delta (CSNK1D) Rabbit Polyclonal Antibody
TA349833

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CSNK1D Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1D
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA312479

USD 380.00

In Stock

Rabbit polyclonal anti-CKI-e antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-e.
TPTEP2-CSNK1E Rabbit Polyclonal Antibody
AP20419PU-N

USD 465.00

3 Weeks

TPTEP2-CSNK1E rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 250-350 of Human Casein Kinase Iε.
Casein Kinase 1 delta (CSNK1D) Rabbit Polyclonal Antibody
TA340031

USD 539.00

5 Days

Rabbit Polyclonal Anti-CSNK1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1D antibody: synthetic peptide directed towards the middle region of human CSNK1D. Synthetic peptide located within the following region: NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA340032

USD 539.00

5 Days

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1E antibody: synthetic peptide directed towards the N terminal of human CSNK1E. Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH