Rabbit Polyclonal Anti-PPM1M Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPM1M antibody: synthetic peptide directed towards the middle region of human PPM1M. Synthetic peptide located within the following region: VYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKY |
Rabbit Polyclonal Anti-PPM1M Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPM1M antibody: synthetic peptide directed towards the middle region of human PPM1M. Synthetic peptide located within the following region: RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL |
Germany
Japan
United Kingdom
China