Antibodies

Jump to Filters
View as table Download
DUSP10 Rabbit Polyclonal Antibody
TA349312

USD 380.00

In Stock

Rabbit Polyclonal Anti-DUSP10 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP10
DUSP10 Rabbit Polyclonal Antibody
TA340368

USD 539.00

5 Days

Rabbit Polyclonal Anti-DUSP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUSP10 antibody: synthetic peptide directed towards the N terminal of human DUSP10. Synthetic peptide located within the following region: MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE
DUSP10 Rabbit Polyclonal Antibody
TA326143

USD 380.00

In Stock

Rabbit polyclonal DUSP10 antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human DUSP10.