Rabbit Polyclonal Anti-DUSP10 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DUSP10 |
Rabbit Polyclonal Anti-DUSP10 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DUSP10 |
Rabbit Polyclonal Anti-DUSP10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DUSP10 antibody: synthetic peptide directed towards the N terminal of human DUSP10. Synthetic peptide located within the following region: MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE |
Rabbit polyclonal DUSP10 antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DUSP10. |