Antibodies

Jump to Filters
View as table Download
PPP1R1C Rabbit Polyclonal Antibody
TA316164

USD 380.00

4 Weeks

Rabbit polyclonal anti-PPP1R1C antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP1R1C.
PPP1R1C Rabbit Polyclonal Antibody
TA334115

USD 539.00

5 Days

Rabbit Polyclonal Anti-PPP1R1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPP1R1C Antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1R1C. Synthetic peptide located within the following region: GELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRD