Antibodies

Jump to Filters
View as table Download
Cpn10 (HSPE1) Rabbit Polyclonal Antibody
TA313120

USD 380.00

In Stock

Rabbit polyclonal anti-HSP10 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HSP10.
Cpn10 (HSPE1) Rabbit Polyclonal Antibody
TA351269

USD 380.00

In Stock

Rabbit Polyclonal Anti-HSPE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HSPE1
Cpn10 (HSPE1) Rabbit Polyclonal Antibody [Clone ID: N/A]
TA326425

USD 455.00

2 Weeks

Rabbit polyclonal Cpn10 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Pig, Rabbit, Sheep, Xenopus
Conjugation Unconjugated
Immunogen Human Cpn10 peptide AA 91-101
Cpn10 (HSPE1) Rabbit Polyclonal Antibody
TA335046

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSPE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPE1 antibody: synthetic peptide directed towards the middle region of human HSPE1. Synthetic peptide located within the following region: GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Cpn10 (HSPE1) Rabbit Polyclonal Antibody
TA347404

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-HSP10 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSP10 Antibody: A synthesized peptide derived from human HSP10