Antibodies

View as table Download

MINPP1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 35-63 amino acids from the N-terminal region of Human MINPP1

Rabbit polyclonal antibody to MIPP (multiple inositol polyphosphate histidine phosphatase, 1)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 246 and 487 of MIPP (Uniprot ID#Q9UNW1)

Rabbit polyclonal anti-MINPP1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MINPP1.

Rabbit Polyclonal Anti-MINPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MINPP1 antibody is: synthetic peptide directed towards the C-terminal region of Human MINPP1. Synthetic peptide located within the following region: VPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDL