Antibodies

Jump to Filters
View as table Download
Galactoside 2 alpha L fucosyltransferase 1 (FUT1) Rabbit Polyclonal Antibody
TA334650

USD 539.00

5 Days

Rabbit Polyclonal Anti-FUT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUT1 antibody: synthetic peptide directed towards the middle region of human FUT1. Synthetic peptide located within the following region: EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL
Galactoside 2 alpha L fucosyltransferase 1 (FUT1) Rabbit Polyclonal Antibody
AP17406PU-N

USD 580.00

2 Weeks

Galactoside 2 alpha L fucosyltransferase 1 (FUT1) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human FUT1