Rabbit Polyclonal Anti-SLC39A6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC39A6 Antibody: synthetic peptide directed towards the middle region of human SLC39A6. Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN |
SLC39A6 / LIV-1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey (Predicted: Horse) |
| Conjugation | Unconjugated |
| Immunogen | SLC39A6 / LIV-1 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human SLC39A6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Orangutan, Gibbon, Horse (94%); Marmoset, Dog, Bovine, Panda (89%); Mouse, Rat, Bat, Rabbit (83%). |
Germany
Japan
United Kingdom
China
