Antibodies

Jump to Filters
View as table Download
MID1 Rabbit Polyclonal Antibody
TA311672

USD 380.00

In Stock

Rabbit polyclonal anti-TRI18/MID1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TRI18.
MID1 Rabbit Polyclonal Antibody
TA337286

USD 485.00

5 Days

Rabbit Polyclonal Anti-MID1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MID1 antibody: synthetic peptide directed towards the C terminal of human MID1. Synthetic peptide located within the following region: AINQAGSRSSEPGKLKTNSQPFKLDPKSAHRKLKVSHDNLTVERDESSSK
MID1 Rabbit Polyclonal Antibody
TA344482

USD 539.00

5 Days

Rabbit Polyclonal Anti-MID1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MID1 antibody is: synthetic peptide directed towards the N-terminal region of Human MID1. Synthetic peptide located within the following region: PTCRHVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAF
MID1 Rabbit Polyclonal Antibody
TA347530

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-TRI18 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TRI18 Antibody: A synthesized peptide derived from human TRI18