Antibodies

Jump to Filters
View as table Download
Seladin 1 (DHCR24) Rabbit Polyclonal Antibody
TA350394

USD 380.00

In Stock

Rabbit Polyclonal Anti-DHCR24 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DHCR24
Seladin 1 (DHCR24) Rabbit Polyclonal Antibody
TA341955

USD 539.00

5 Days

Rabbit Polyclonal Anti-DHCR24 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHCR24 antibody: synthetic peptide directed towards the N terminal of human DHCR24. Synthetic peptide located within the following region: FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK
Seladin 1 (DHCR24) Rabbit Polyclonal Antibody
TA341956

USD 539.00

5 Days

Rabbit Polyclonal Anti-DHCR24 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHCR24 antibody: synthetic peptide directed towards the middle region of human DHCR24. Synthetic peptide located within the following region: AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE