Antibodies

Jump to Filters
View as table Download
E2F3 Rabbit Polyclonal Antibody
TA349084

USD 570.00

5 Days

Rabbit Polyclonal Anti-E2F3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen E2F3 antibody was raised against a 15 amino acid peptide near the center of human E2F3.
E2F3 Rabbit Polyclonal Antibody
TA335211

USD 539.00

5 Days

Rabbit Polyclonal Anti-E2F3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F3 antibody: synthetic peptide directed towards the C terminal of human E2F3. Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK