Antibodies

Jump to Filters
View as table Download
Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody
AP23334PU-N

USD 560.00

2 Weeks

Neurotrophin 3 (NTF3) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide mapping at the middle region of Human Neurotrophin-3
Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody
TA342144

USD 539.00

5 Days

Rabbit polyclonal Anti-Ntf3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ntf3 antibody is: synthetic peptide directed towards the N-terminal region of Ntf3. Synthetic peptide located within the following region: LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY