B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
B1R / BDKRB1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%); Rat, Hamster (89%); Mouse, Rabbit, Horse (83%). |
Rabbit Polyclonal Anti-BDKRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDKRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human BDKRB1. Synthetic peptide located within the following region: RTREEVSRTRCGGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQ |
Germany
Japan
United Kingdom
China
