Antibodies

Jump to Filters
View as table Download
XPB (ERCC3) Rabbit Polyclonal Antibody
TA327151

USD 365.00

3 Weeks

ERCC3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human ERCC3
XPB (ERCC3) Rabbit Polyclonal Antibody
TA335162

USD 539.00

5 Days

Rabbit Polyclonal Anti-ERCC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC3 antibody: synthetic peptide directed towards the N terminal of human ERCC3. Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG