Antibodies

Jump to Filters
View as table Download
5HT3E (HTR3E) Rabbit Polyclonal Antibody
TA338785

USD 539.00

5 Days

Rabbit Polyclonal Anti-HTR3E Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR3E antibody: synthetic peptide directed towards the middle region of human HTR3E. Synthetic peptide located within the following region: RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG
5HT3E (HTR3E) Rabbit Polyclonal Antibody
TA337723

USD 539.00

5 Days

Rabbit Polyclonal Anti-HTR3E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR3E antibody is: synthetic peptide directed towards the C-terminal region of Human HTR3E. Synthetic peptide located within the following region: GPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFM