Rabbit Polyclonal Anti-UBE2N Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-UBE2N Antibody: synthetic peptide directed towards the middle region of human UBE2N. Synthetic peptide located within the following region: GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE |
Rabbit Polyclonal Anti-UBE2N Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2N antibody: synthetic peptide directed towards the middle region of human UBE2N. Synthetic peptide located within the following region: VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW |
Germany
Japan
United Kingdom
China
