Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Acetyl-Histone H4 (Lys16) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic Peptide of Histone H4 (Acetyl Lys16) (Acetylated) |
HIST4H4 (Citrulline R3) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from N-term region of Human Histone H4, containing Citrulline at position 3 |
HIST4H4 (acetyl K5) rabbit polyclonal antibody, Serum
| Applications | ChIP, ELISA, IF, IP, WB |
| Reactivities | Amphibian, Drosophila, Mammalian, Plant, Yeast |
| Conjugation | Unconjugated |
| Immunogen | Ovalbumin-conjugated peptide. |
Phospho-Histone H4 (Ser1) Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S1 of human Histone H4.Email for sequence (Phosphorylated) |
HIST4H4 (acetylated) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IP, WB |
| Reactivities | Amphibian, Drosophila, Mammalian, Yeast |
| Conjugation | Unconjugated |
| Immunogen | KLH-conjugated peptide acetylated at lysines 5,8,12,16 |
Rabbit Polyclonal Anti-HIST1H4A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HIST1H4A antibody is: synthetic peptide directed towards the N-terminal region of Human HIST1H4A. Synthetic peptide located within the following region: LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK |
Active filters
Category
- Antibodies
Target Symbol
- H4C1
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal