Antibodies

Jump to Filters
View as table Download
BCAT1 Rabbit Polyclonal Antibody
TA349704

USD 380.00

In Stock

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BCAT1
BCAT1 (Center) Rabbit Polyclonal Antibody
AP50350PU-N

USD 580.00

2 Weeks

BCAT1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 88-115 amino acids from the Central region of human BCAT1
BCAT1 Rabbit Polyclonal Antibody
TA339285

USD 539.00

5 Days

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCAT1 antibody: synthetic peptide directed towards the N terminal of human BCAT1. Synthetic peptide located within the following region: MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG