Antibodies

View as table Download

DHX58 rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DHX58 antibody was raised against 11 amino acid peptide from near the center of human LGP2

Rabbit Polyclonal LGP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LGP2 antibody was raised against a 11 amino acid peptide from near the center of human LGP2.

Rabbit Polyclonal LGP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LGP2 antibody was raised against a 12 amino acid peptide from near the carboxy terminus of human LGP2.

Rabbit Polyclonal LGP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LGP2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human LGP2.

Rabbit Polyclonal Anti-DHX58 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHX58 antibody: synthetic peptide directed towards the N terminal of human DHX58. Synthetic peptide located within the following region: AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM