Antibodies

Jump to Filters
View as table Download
ALG2 Rabbit Polyclonal Antibody
TA322120

USD 380.00

In Stock

Anti-ALG2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human ALG2, alpha-1,3/1,6-mannosyltransferase
ALG2 Rabbit Polyclonal Antibody
TA322121

USD 380.00

In Stock

Anti-ALG2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human ALG2, alpha-1,3/1,6-mannosyltransferase
ALG2 Rabbit Polyclonal Antibody
AP43589PU-N

USD 430.00

2 Weeks

ALG2 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat, African clawed frog
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the C terminal of human ALG2
ALG2 Rabbit Polyclonal Antibody
TA346855

USD 539.00

5 Days

Rabbit Polyclonal Anti-ALG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALG2 antibody: synthetic peptide directed towards the C terminal of human ALG2. Synthetic peptide located within the following region: QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC