Antibodies

Jump to Filters
View as table Download
IDH3A Rabbit Polyclonal Antibody
TA346407

USD 485.00

5 Days

Rabbit Polyclonal Anti-IDH3A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IDH3A antibody: synthetic peptide directed towards the N terminal of human IDH3A. Synthetic peptide located within the following region: MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK
IDH3A Rabbit Polyclonal Antibody
TA346408

USD 539.00

5 Days

Rabbit Polyclonal Anti-IDH3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IDH3A antibody: synthetic peptide directed towards the middle region of human IDH3A. Synthetic peptide located within the following region: RHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRVKDL