Antibodies

Jump to Filters
View as table Download
SCTR Rabbit Polyclonal Antibody
TA322924

USD 380.00

In Stock

Anti-SCTR Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 120-134 amino acids of human secretin receptor
SCTR Rabbit Polyclonal Antibody
TA322923

USD 380.00

4 Weeks

Anti-SCTR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 120-134 amino acids of human secretin receptor
SCTR Rabbit Polyclonal Antibody
TA314517

USD 380.00

In Stock

Rabbit polyclonal anti-SCTR antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SCTR.
SCTR Rabbit Polyclonal Antibody
TA338246

USD 539.00

5 Days

Rabbit Polyclonal Anti-SCTR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCTR antibody is: synthetic peptide directed towards the N-terminal region of Human SCTR. Synthetic peptide located within the following region: NLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRR