Antibodies

Jump to Filters
View as table Download
HTR2C Rabbit Polyclonal Antibody
TA330447

USD 485.00

5 Days

Rabbit Polyclonal Anti-HTR2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR2C antibody: synthetic peptide directed towards the N terminal of human HTR2C. Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA
HTR2C Rabbit Polyclonal Antibody
TA313299

USD 380.00

In Stock

Rabbit polyclonal anti-5-HT-2C antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2C.
HTR2C Rabbit Polyclonal Antibody
TA350954

USD 380.00

In Stock

Rabbit Polyclonal Anti-HTR2C Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HTR2C