TdT (DNTT) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human TDT |
TdT (DNTT) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human TDT |
Rabbit Polyclonal Anti-DNTT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNTT antibody: synthetic peptide directed towards the N terminal of human DNTT. Synthetic peptide located within the following region: FQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSG |
Rabbit Polyclonal Anti-DNTT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNTT antibody: synthetic peptide directed towards the middle region of human DNTT. Synthetic peptide located within the following region: LRRYATHERKMILDNHALYDKTKRIFLKAESEEEIFAHLGLDYIEPWERN |