Antibodies

Jump to Filters
View as table Download
SPIRE2 Rabbit Polyclonal Antibody
TA349526

USD 380.00

In Stock

Rabbit Polyclonal Anti-SPIRE2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SPIRE2
SPIRE2 Rabbit Polyclonal Antibody
TA342930

USD 539.00

5 Days

Rabbit Polyclonal Anti-SPIRE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPIRE2 antibody: synthetic peptide directed towards the N terminal of human SPIRE2. Synthetic peptide located within the following region: EAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDSGCG