Antibodies

Jump to Filters
View as table Download
CLCA4 Rabbit Polyclonal Antibody
TA321811

USD 380.00

4 Weeks

Anti-CLCA4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 306-476 amino acids of Human Calcium-activated chloride channel regulator 4
CLCA1 Rabbit Polyclonal Antibody
TA307979

USD 625.00

5 Days

Rabbit Polyclonal antibody to CLCA1 (chloride channel accessory 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 542 and 633 of CLCA1 (Uniprot ID#A8K7I4)
CLCA4 Rabbit Polyclonal Antibody
TA321812

USD 380.00

4 Weeks

Anti-CLCA4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 306-476 amino acids of human Calcium-activated chloride channel regulator 4
CLCA2 Rabbit Polyclonal Antibody
TA338561

USD 539.00

5 Days

Rabbit Polyclonal Anti-CLCA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLCA2 antibody: synthetic peptide directed towards the C terminal of human CLCA2. Synthetic peptide located within the following region: RYFFSFAANGRYSLKVHVNHSPSISTPAHSIPGSHAMYVPGYTANGNIQM