Antibodies

Jump to Filters
View as table Download
CHRNA5 Rabbit Polyclonal Antibody
TA327158

USD 365.00

3 Weeks

CHRNA5 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CHRNA5
CHRNA5 Rabbit Polyclonal Antibody
TA338362

USD 539.00

5 Days

Rabbit Polyclonal Anti-CHRNA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA5 antibody: synthetic peptide directed towards the middle region of human CHRNA5. Synthetic peptide located within the following region: PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD
CHRNA5 Rabbit Polyclonal Antibody
TA338363

USD 485.00

5 Days

Rabbit Polyclonal Anti-CHRNA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA5 antibody: synthetic peptide directed towards the middle region of human CHRNA5. Synthetic peptide located within the following region: DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS