Antibodies

Jump to Filters
View as table Download
CHRNA3 Rabbit Polyclonal Antibody
TA321194

USD 380.00

4 Weeks

Anti-CHRNA3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 69-83 amino acids of Human cholinergic receptor, nicotinic, alpha 3 (neuronal)
CHRNA3 Rabbit Polyclonal Antibody
TA330421

USD 539.00

5 Days

Rabbit Polyclonal Anti-CHRNA3 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA3 antibody: synthetic peptide directed towards the N terminal of human CHRNA3. Synthetic peptide located within the following region: LPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVD