Antibodies

Jump to Filters
View as table Download
DCXR Rabbit Polyclonal Antibody
TA344125

USD 539.00

5 Days

Rabbit Polyclonal Anti-DCXR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCXR antibody: synthetic peptide directed towards the middle region of human DCXR. Synthetic peptide located within the following region: STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM
DCXR Rabbit Polyclonal Antibody
TA308568

USD 625.00

5 Days

Rabbit polyclonal antibody to L-xylulose reductase (dicarbonyl/L-xylulose reductase)

Applications WB
Reactivities Human (Predicted: Mouse, Guinea Pig)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 182 and 244 of DCXR (Uniprot ID#Q7Z4W1)