Antibodies

Jump to Filters
View as table Download
beta glucuronidase (GUSB) Rabbit Polyclonal Antibody
TA334656

USD 485.00

5 Days

Rabbit Polyclonal Anti-GUSB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF
beta glucuronidase (GUSB) Rabbit Polyclonal Antibody
TA313989

USD 380.00

4 Weeks

Rabbit polyclonal anti-GUSB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GUSB.