Antibodies

Jump to Filters
View as table Download
MRE11 Rabbit Polyclonal Antibody
TA301767

USD 550.00

5 Days

Rabbit Polyclonal Antibody against Mre11

Applications ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length human Mre11 protein
MRE11 Rabbit Polyclonal Antibody
TA350181

USD 380.00

In Stock

Rabbit Polyclonal Anti-MRE11A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MRE11A
MRE11 Rabbit Polyclonal Antibody
TA306897

USD 570.00

5 Days

Rabbit Polyclonal MRE11 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MRE11 antibody was raised against a 14 amino acid peptide from near the amino terminus human MRE11.
MRE11 Rabbit Polyclonal Antibody
TA351410

USD 380.00

In Stock

Rabbit Polyclonal Anti-MRE11A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MRE11A
MRE11 Rabbit Polyclonal Antibody
TA332553

USD 365.00

3 Weeks

Rabbit anti-MRE11A Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MRE11A
MRE11 Rabbit Polyclonal Antibody
TA342247

USD 539.00

2 Weeks

Rabbit polyclonal Anti-MRE11A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MRE11A antibody: synthetic peptide directed towards the N terminal of human MRE11A. Synthetic peptide located within the following region: DTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCM
MRE11 Rabbit Polyclonal Antibody
TA319244

USD 765.00

5 Days

Rabbit polyclonal anti-Mre11 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corres-ponding to amino acids 68-706 of mouse Mre11 protein.
MRE11 Rabbit Polyclonal Antibody
TA319245

USD 765.00

5 Days

Rabbit polyclonal anti-Mre11 antibody

Applications IP
Reactivities Saccharomyces cerevisiae
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 578-590 of Saccharomyces cerevisiae (baker's yeast) Mre11 protein.
MRE11 Rabbit Polyclonal Antibody
TA342248

USD 539.00

5 Days

Rabbit polyclonal Anti-MRE11A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MRE11A antibody: synthetic peptide directed towards the middle region of human MRE11A. Synthetic peptide located within the following region: RFRETRQKNTNEEDDEVREAMTRARALRSQSEESASAFSADDLMSIDLAE
MRE11 Rabbit Polyclonal Antibody
TA347972

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-MRE11A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MRE11A Antibody: A synthesized peptide derived from human MRE11A