ATP6V1G3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human ATP6V1G3 (NP_573569.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-ATP6V1G3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atp6v1g3 antibody is: synthetic peptide directed towards the middle region of Mouse Atp6v1g3. Synthetic peptide located within the following region: MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQ |
Germany
Japan
United Kingdom
China