Antibodies

View as table Download

Rabbit polyclonal anti-WASF3 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human WASF3.

Rabbit Polyclonal Anti-WASF3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WASF3

Rabbit Polyclonal Anti-WASF3 Antibody

Applications WB
Reactivities Human, Chicken, Turkey
Conjugation Unconjugated
Immunogen The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the N terminal of human WASF3. Synthetic peptide located within the following region: NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK

Rabbit Polyclonal Anti-WASF3 Antibody

Applications WB
Reactivities Human, Chicken, Turkey
Conjugation Unconjugated
Immunogen The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the middle region of human WASF3. Synthetic peptide located within the following region: RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS