Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast |
| Conjugation | Unconjugated |
| Immunogen | Recombinant human Caspase-3 protein (full length) |
Rabbit Polyclonal Anti-PIK3R3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIK3R3 antibody is: synthetic peptide directed towards the C-terminal region of Human PIK3R3. Synthetic peptide located within the following region: DAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIK |
Rabbit Polyclonal Anti-TGF beta1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta. |
Germany
Japan
United Kingdom
China