Antibodies

Jump to Filters
View as table Download
Growth hormone receptor (GHR) Rabbit Polyclonal Antibody
TA323722

USD 380.00

2 Weeks

Anti-GHR Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 48-63 amino acids of Human growth hormone receptor
Growth hormone receptor (GHR) Rabbit Polyclonal Antibody
TA334654

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-GHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHR antibody: synthetic peptide directed towards the N terminal of human GHR. Synthetic peptide located within the following region: LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF