Antibodies

Jump to Filters
View as table Download
COX2 (PTGS2) Rabbit Polyclonal Antibody
TA313292

USD 380.00

2 Weeks

Rabbit polyclonal anti-Cox2 (PTGS2) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cox2.
ALOX15 Rabbit Polyclonal Antibody
TA350961

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ALOX15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ALOX15
PLA2G3 Rabbit Polyclonal Antibody
TA308426

USD 625.00

2 Weeks

Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20)
Cytochrome P450 2C9 (CYP2C9) Rabbit Polyclonal Antibody
TA349844

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CYP2C9 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP2C9
Cytochrome p450 2J2 (CYP2J2) (N-term) Rabbit Polyclonal Antibody
AP17970PU-N

USD 580.00

2 Weeks

Cytochrome p450 2J2 (CYP2J2) (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CYP2J2
LTC4S Rabbit Polyclonal Antibody
TA330968

USD 539.00

2 Weeks

Rabbit polyclonal Anti-LTC4S Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LTC4S antibody: synthetic peptide directed towards the N terminal of human LTC4S. Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY