Antibodies

Jump to Filters
View as table Download
ALDH6A1 Rabbit Polyclonal Antibody
TA324300

USD 380.00

In Stock

Anti-ALDH6A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1
ALDH6A1 Rabbit Polyclonal Antibody
TA324301

USD 380.00

In Stock

Anti-ALDH6A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1
PIP5K1 alpha (PIP5K1A) Rabbit Polyclonal Antibody
TA349607

USD 380.00

In Stock

Rabbit Polyclonal Anti-PIP5K1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PIP5K1A
PIP5K2 alpha (PIP4K2A) Rabbit Polyclonal Antibody
TA349651

USD 380.00

In Stock

Rabbit Polyclonal Anti-PIP4K2A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PIP4K2A
Phospholipase C beta 3 (PLCB3) Rabbit Polyclonal Antibody
TA351534

USD 380.00

In Stock

Rabbit Polyclonal Anti-PLCB3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLCB3
PIP5K1 beta (PIP5K1B) Rabbit Polyclonal Antibody
TA349650

USD 380.00

In Stock

Rabbit Polyclonal Anti-PIP5K1B Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PIP5K1B
PI 3 Kinase Class 3 (PIK3C3) Rabbit Polyclonal Antibody
TA350888

USD 380.00

In Stock

Rabbit Polyclonal Anti-PIK3C3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIK3C3
PIK3CB Rabbit Polyclonal Antibody
TA351530

USD 380.00

In Stock

Rabbit Polyclonal Anti-PIK3CB Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIK3CB
SKIP (INPP5K) Rabbit Polyclonal Antibody
TA343120

USD 539.00

In Stock

Rabbit Polyclonal Anti-INPP5K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF
PTEN Rabbit Polyclonal Antibody
TA313350

USD 380.00

In Stock

Rabbit polyclonal PTEN (Ab-370) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370.
PI 3 Kinase catalytic subunit gamma (PIK3CG) Rabbit Polyclonal Antibody
TA326145

USD 380.00

In Stock

Rabbit polyclonal PIK3CG antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PIK3CG.
PLCZ1 Rabbit Polyclonal Antibody
TA350288

USD 380.00

In Stock

Rabbit Polyclonal Anti-PLCZ1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PLCZ1
PIK3CD Rabbit Polyclonal Antibody
TA351528

USD 380.00

In Stock

Rabbit Polyclonal Anti-PIK3CD Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIK3CD
PIK3C2G Rabbit Polyclonal Antibody
TA314341

USD 380.00

In Stock

Rabbit polyclonal anti-PIK3C2G antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human P3C2G.