Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-ABCB6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6 |
Anti-ABCB9 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 9 |
Anti-ABCB6 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6 |
Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2) |
Rabbit Polyclonal Anti-Abca7 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |
Active filters
Category
- Antibodies
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Druggable Genome
Pathways
- ABC transporters
Availabilities
- In Stock