Antibodies

Jump to Filters
View as table Download
SLC26A9 Rabbit Polyclonal Antibody
TA333569

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC26A9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC26A9 Antibody: synthetic peptide directed towards the middle region of human SLC26A9. Synthetic peptide located within the following region: LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD
SLC26A9 Rabbit Polyclonal Antibody
TA381621

USD 365.00

3 Weeks

SLC26A9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SLC26A9.