Rabbit Polyclonal antibody to GIPC1 (GIPC PDZ domain containing family, member 1)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 273 and 333 of GIPC1 |
Rabbit Polyclonal Anti-GIPC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GIPC2 antibody: synthetic peptide directed towards the N terminal of human GIPC2. Synthetic peptide located within the following region: MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH |
Rabbit Polyclonal Anti-GIPC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GIPC2 antibody is: synthetic peptide directed towards the C-terminal region of Human GIPC2. Synthetic peptide located within the following region: KAKAIEKIDDVLELYMGIRDIDLATTMFEAGKDKVNPDEFAVALDETLGD |
Rabbit Polyclonal Anti-GIPC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GIPC1 antibody: synthetic peptide directed towards the N terminal of human GIPC1. Synthetic peptide located within the following region: SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA |
GIPC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GIPC1 |
Rabbit anti-GIPC2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GIPC2 |
Germany
Japan
United Kingdom
China
