Antibodies

Jump to Filters
View as table Download
GDI2 Rabbit Polyclonal Antibody
TA365851

USD 380.00

4 Weeks

GDI2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GDI2
GDI2 Rabbit Polyclonal Antibody
TA370192

USD 380.00

4 Weeks

GDI2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GDI2
GDI2 Rabbit Polyclonal Antibody
TA376534

USD 450.00

3 Weeks

GDI2 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 296-445 of human GDI2 (NP_001485.2).
Modifications Unmodified
GDI2 Rabbit Polyclonal Antibody
TA330442

USD 539.00

5 Days

Rabbit Polyclonal Anti-GDI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GDI2 antibody: synthetic peptide directed towards the C terminal of human GDI2. Synthetic peptide located within the following region: EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHF