Rabbit polyclonal antibody to FBXL3 (F-box and leucine-rich repeat protein 3)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Rat, Sheep, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 14 and 309 of FBXL3 (Uniprot ID#Q9UKT7) |
Fbxl3 (1-5) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.1~5 derived from mouse FBXL3 |
Fbxl3 (1-5) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.1~5 derived from mouse FBXL3 |
Rabbit Polyclonal Anti-FBXL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXL3 antibody: synthetic peptide directed towards the middle region of human FBXL3. Synthetic peptide located within the following region: LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV |
Fbxl3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Fbxl3 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Cter domain of mouse FBXL3 protein |
Germany
Japan
United Kingdom
China
