Antibodies

Jump to Filters
View as table Download
RPS23 Rabbit Polyclonal Antibody
TA314496

USD 380.00

4 Weeks

Rabbit polyclonal anti-RPS23 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human RPS23.
Rps23 Rabbit Polyclonal Antibody
TA337937

USD 539.00

5 Days

Rabbit Polyclonal Anti-Rps23 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rps23 antibody is: synthetic peptide directed towards the N-terminal region of Rat Rps23. Synthetic peptide located within the following region: SHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNS
RPS23 Rabbit Polyclonal Antibody
TA381104

USD 365.00

3 Weeks

RPS23 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human RPS23 (NP_001016.1).
Modifications Unmodified