Antibodies

Jump to Filters
View as table Download
TBXAS1 (Center) Rabbit Polyclonal Antibody
AP51174PU-N

USD 580.00

2 Weeks

TBXAS1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 234-266 amino acids from the Central region of Human CYP5A1.
TBXAS1 Rabbit Polyclonal Antibody
TA313205

USD 380.00

In Stock

Rabbit polyclonal anti-THAS antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human THAS.
TBXAS1 Rabbit Polyclonal Antibody
TA332490

USD 365.00

3 Weeks

Rabbit anti-TBXAS1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TBXAS1
TBXAS1 Rabbit Polyclonal Antibody
TA337958

USD 539.00

5 Days

Rabbit Polyclonal Anti-TBXAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: GYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLP
TBXAS1 Rabbit Polyclonal Antibody
TA338328

USD 539.00

5 Days

Rabbit Polyclonal Anti-TBXAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: LDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIV