Antibodies

Jump to Filters
View as table Download
TPM1 Rabbit Polyclonal Antibody
TA323683

USD 380.00

4 Weeks

Anti-TPM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
TPM1 Rabbit Polyclonal Antibody
TA323684

USD 380.00

2 Weeks

Anti-TPM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
TPM1 Rabbit Polyclonal Antibody
TA346063

USD 539.00

5 Days

Rabbit Polyclonal Anti-TPM1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the middle region of human TPM1. Synthetic peptide located within the following region: LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED