Antibodies

Jump to Filters
View as table Download
HYAL1 Rabbit Polyclonal Antibody
TA339811

USD 539.00

5 Days

Rabbit Polyclonal Anti-HYAL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HYAL1 antibody: synthetic peptide directed towards the N terminal of human HYAL1. Synthetic peptide located within the following region: WNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYY
HYAL1 Rabbit Polyclonal Antibody
TA339812

USD 539.00

5 Days

Rabbit Polyclonal Anti-HYAL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HYAL1 antibody: synthetic peptide directed towards the N terminal of human HYAL1. Synthetic peptide located within the following region: TIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPD