Rabbit Polyclonal Anti-IDUA Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Idua antibody is: synthetic peptide directed towards the middle region of MOUSE Idua. Synthetic peptide located within the following region: MENQLLPGFELMGSPSGYFTDFDDKQQVFEWKDLVSLLARRYIGRYGLTH |
Rabbit Polyclonal Anti-SGSH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SGSH antibody is: synthetic peptide directed towards the N-terminal region of Human SGSH. Synthetic peptide located within the following region: RNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSCSP |
GNS rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human GNS |
GNS rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human GNS |
ARSB (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human ARSB |
HEXA rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human HEXA |
SGSH (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 427~457 amino acids from the C-terminal region of Human SGSH. |
Rabbit polyclonal anti-ARSB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ARSB. |
Rabbit anti-HEXA Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HEXA |
Rabbit Polyclonal Anti-HGSNAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HGSNAT antibody is: synthetic peptide directed towards the N-terminal region of Human HGSNAT. Synthetic peptide located within the following region: RALAALLLAASVLSAALLAPGGSSGRDAQAAPPRDLDKKRHAELKMDQAL |
Rabbit Polyclonal Anti-HPSE2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HPSE2 antibody is: synthetic peptide directed towards the N-terminal region of Human HPSE2. Synthetic peptide located within the following region: SPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDEPNNYRTMH |
Rabbit Polyclonal Anti-HPSE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HPSE antibody: synthetic peptide directed towards the N terminal of human HPSE. Synthetic peptide located within the following region: DPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSY |
Rabbit Polyclonal Anti-HPSE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HPSE antibody: synthetic peptide directed towards the N terminal of human HPSE. Synthetic peptide located within the following region: KLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGL |
Rabbit Polyclonal Anti-IDUA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IDUA antibody is: synthetic peptide directed towards the C-terminal region of Human IDUA. Synthetic peptide located within the following region: DPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALP |
Rabbit Polyclonal Anti-SGSH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SGSH antibody is: synthetic peptide directed towards the C-terminal region of Human SGSH. Synthetic peptide located within the following region: ARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAP |
Germany
Japan
United Kingdom
China