PI3 Kinase p110 beta Rabbit polyclonal Antibody
Applications | FC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human PI3 Kinase p110 beta |
PI3 Kinase p110 beta Rabbit polyclonal Antibody
Applications | FC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human PI3 Kinase p110 beta |
Rabbit Polyclonal Anti-PIK3CB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB. Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD |
PI3 Kinase p110 beta Rabbit monoclonal Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PIK3CB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PIK3CB antibody is: synthetic peptide directed towards the N-terminal region of Human PIK3CB. Synthetic peptide located within the following region: ENATALHVKFPENKKQPYYYPPFDKSRGGKKFLPVLKEILDRDPLSQLCE |
PI3 Kinase p110 beta Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 771-1070 of human PI3 Kinase p110 beta (NP_006210.1). |
Modifications | Unmodified |