DDX59 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DDX59 |
DDX59 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DDX59 |
Rabbit Polyclonal Anti-DDX59 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DDX59 antibody: synthetic peptide directed towards the middle region of human DDX59. Synthetic peptide located within the following region: PQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTR |
DDX59 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human DDX59 (NP_001026895.2). |
Modifications | Unmodified |