Antibodies

View as table Download

DDX59 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DDX59

Rabbit Polyclonal Anti-DDX59 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX59 antibody: synthetic peptide directed towards the middle region of human DDX59. Synthetic peptide located within the following region: PQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTR

DDX59 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human DDX59 (NP_001026895.2).
Modifications Unmodified