Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Anti-ACO2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 766-780 amino acids of human aconitase 2, mitochondrial |
Rabbit polyclonal IREB1 / ACO1 (Ser711) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IREB1 around the phosphorylation site of serine 711 (Y-G-SP-R-R). |
| Modifications | Phospho-specific |
Anti-ACO1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 132-146 amino acids of human aconitase 1, soluble |
Rabbit Polyclonal Anti-MDH2 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDH2 antibody: synthetic peptide directed towards the C terminal of human MDH2. Synthetic peptide located within the following region: TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK |
Rabbit Polyclonal Anti-MDH1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MDH1 |
Germany
Japan
United Kingdom
China
